PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 478281
Common NameARALYDRAFT_478281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 298aa    MW: 32751 Da    PI: 9.7867
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
478281genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73.2e-144387147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
           478281 43 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 87
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-173793IPR009057Homeodomain-like
PROSITE profilePS5129416.2913892IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-74193IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-194190IPR006447Myb domain, plants
SMARTSM007171.1E-114290IPR001005SANT/Myb domain
PfamPF002497.1E-124387IPR001005SANT/Myb domain
CDDcd001672.27E-94588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0032922Biological Processcircadian regulation of gene expression
GO:0043966Biological Processhistone H3 acetylation
GO:0046686Biological Processresponse to cadmium ion
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MSSSPSRNPT NAEAPPPQPT STDAVAEGSS KKVRKPYTIT KSRESWTEEE HDKFLEALQL  60
FDRDWKKIED FVGSKTVIQI RSHAQKYFLK VQKNGTLAHV PPPRPKRKAA HPYPQKASKN  120
AQMPLQVSTS FTTSRNSDMP GYASWDDASM LLNRVISPQH ELATLRGAEA DIGSKGLLNV  180
SSPSTSCMGS SSRTVSGSEI VRKAKQPPVL HGVPDFAEVY NFIGSVFDPE TRGHVEKLKE  240
MDPINFETVL LLMRNLTVNL SNPDLESARK VLSSYDVKTE LPSVVSLVKN STSDKSA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00338DAPTransfer from AT3G09600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0911060.0AY091106.1 Arabidopsis thaliana unknown protein (At3g09600) mRNA, complete cds.
GenBankAY1229690.0AY122969.1 Arabidopsis thaliana unknown protein (At3g09600) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882629.10.0myb family transcription factor
SwissprotQ8RWU30.0RVE8_ARATH; Protein REVEILLE 8
TrEMBLD7L8A70.0D7L8A7_ARALL; Myb family transcription factor
STRINGfgenesh2_kg.3__982__AT3G09600.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93032633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.10.0MYB_related family protein